Code |
Context $json = $this->create_JSON($id, '___');
} else {
$json = $this->create_JSON($target_id, '___');
$target_id = "012367"
$split = "___"
$target = array(
"Target" => array(
"id" => "12635",
"target_id" => "012367",
"local_target_id" => "012367",
"locus_tag" => null,
"ncbi_gi" => "213512919",
"ncbi_accession" => "NP_001133615.1",
"ncbi_geneid" => "100195114",
"ncbi_taxon_id" => "8030",
"gene_name" => "stx10",
"common_name" => "Syntaxin-10 [Salmo salar]",
"ncbi_coded_by_region" => "NM_001140143.1:8..751",
"ncbi_note" => null,
"tigr_main_role_id" => null,
"tigr_sub_role_id" => null,
"comment" => null,
"justification" => "Cell:cell adhesive interactions involving the syntaxin family of proteins",
"sequence" => "MSLEDPFFVVKGEVQKALSRARSLYERWEELLEEGTQVSKDELDWSTNELRNCLRAIDWDLEDLSETISIVESNPGKFRLGENELQERRDFVERTRQAVQEMKEQLSSPSVVAQAEKKNRQALMGTSGQDRSDGLESHLVSANSRYIQDQQEQQQLIMQDQDEQLELVTGSIRVLKDMSGRIGDELDQQAVMLGEFGEEMDQTGSRMDSVLKKMEKVSHMTSSRRQWCAIGVLVVIMVVVLILFFTL",
"sequence_length" => "247",
"dna_sequence" => "ATGTCGCTGGAGGACCCATTCTTCGTTGTTAAGGGAGAGGTTCAAAAGGCCCTGAGCAGAGCCCGTTCACTGTACGAGCGTTGGGAAGAGCTGCTCGAGGAAGGTACCCAGGTCTCGAAGGACGAGCTGGATTGGTCAACTAACGAATTGAGGAACTGCCTGAGAGCTATCGACTGGGATCTGGAGGACCTCTCTGAAACTATCAGCATCGTTGAGTCAAACCCCGGCAAGTTCAGGCTGGGCGAGAACGAACTCCAAGAGCGTCGCGACTTCGTGGAACGTACACGCCAAGCCGTCCAGGAGATGAAGGAACAGCTGTCCTCTCCTTCCGTGGTCGCTCAAGCCGAGAAGAAGAACAGGCAGGCTCTCATGGGTACCTCTGGCCAGGACAGAAGCGATGGCCTCGAGTCACACTTGGTCTCGGCCAACTCCCGTTACATCCAAGACCAGCAAGAACAGCAACAGTTGATCATGCAAGACCAGGATGAGCAGTTGGAACTGGTCACTGGATCTATCCGTGTTCTCAAGGACATGAGCGGACGCATCGGTGACGAGTTGGATCAACAGGCTGTCATGCTGGGCGAATTCGGAGAGGAAATGGACCAAACAGGATCGCGCATGGATTCCGTTCTGAAGAAGATGGAGAAGGTGTCTCACATGACCAGCTCAAGGAGACAGTGGTGTGCCATCGGTGTGCTCGTTGTGATCATGGTCGTTGTGCTCATCTTGTTCTTCACCTTGTAA",
"dna_sequence_ncbi" => null,
"priority" => "1",
"project" => "CAD:SYN",
"selection_phase" => null,
"date_selected" => "2011-06-28",
"date_approved" => "2011-06-28",
"completion_code" => null,
"pi" => null,
"tms" => null,
"sp" => null,
"core_genome" => null,
"gram_minus_gene_homolog" => null,
"gram_plus_gene_homolog" => null,
"protease_motifs" => null,
"glycosyl_group_metabolism" => null,
"study_id" => null,
"drug_target_homologs" => null,
"virulence_genes" => null,
"essential_genes_homologs" => null,
"dna_binding_motifs" => null,
"inserted" => "2011-07-25 21:03:08.570266+00",
"updated" => "2011-07-25 21:03:08.570266+00",
"species_taxon_id" => "8030",
"ins_user_id" => "2",
"upd_user_id" => null,
"stage" => "in_crystallization_trials",
"hidden" => false,
"submitter_id" => null,
"selection_db_id" => null,
"dna_source_taxon_id" => null,
"batch" => "syntaxin_batch1",
"genus_taxon_id" => "8028",
"seguid" => null,
"uniprot_id" => null,
"ec" => null,
"target_family" => null,
"tar_designpool_id" => null,
"community_nominated" => false,
"partnership_nominated" => "CELLMAT",
"biomedical" => false,
"metagenomic" => false,
"structural_coverage" => false,
"psi2" => false,
"legacy" => false,
"complex_with_biological_partner" => false,
"functional_mutant" => false,
"conformational_state" => false,
"disease" => false,
"individual_organism" => false,
"protein_family_of_high_biological_importance" => false,
"general_domain_family" => false,
"eukaryotic_domain_family" => false,
"first_structure_of_class" => false,
"functional_follow_up" => false,
"technology_development" => false,
"membrane_protein" => false,
"translated_dna_sequence" => null,
"family_coverage" => null,
"family_coverage_date" => null,
"distribution_lab" => null,
"uniprot_accession" => null,
"protocol_id" => "Target_selection",
"ensembl_protein_id" => null,
"ensembl_gene_id" => null,
"type" => "single protein",
"ligand_studies" => false,
"protein_production_for_partnerships" => false,
"single_domain_protein" => false,
"multidomain_protein" => false,
"oligomeric_protein" => false,
"eukaryotic_protein" => false,
"protein_protein_complex" => false,
"protein_nucleic_acid_complex" => false,
"protein_ligand_complex" => false,
"de_novo_designed_protein" => false,
"post_translational_modification" => false
),
"ProteinClone" => array(
array(),
array(),
array(),
array()
)
)
$filteredLabs = array(
"UVA",
"NU",
"UT",
"WU"
)
$highlighted = array()
$paths = array(
array(
"Target___012367"
),
array(
"Target___012367",
"ProteinClone___30416"
),
array(
"Target___012367",
"ProteinClone___30416",
"Expression___3903"
)
)
$tips = array(
"Target___012367" => array(
"title" => "Target 012367",
"text" => "Syntaxin-10 [Salmo salar]"
),
"ProteinClone___30416" => array(
"title" => "Clone",
"text" => "sequence range: 2-108<br>vector: pSGC<br>person: Brandan Hillerich"
),
"Expression___3903" => array(
"title" => "Expression",
"text" => "expression level: 100.0%<br>solubility level: 100.0%<br>media: PASM-5052 (0.75mL)<br>induction: IPTG (37°C)<br>person: Brandan Hillerich"
),
"Purification___592" => array(
"title" => "Purification",
"text" => "final concentration: 0.29mg/mL<br>SeMet: native<br>affinity tag: na<br>person: Anthony Gizzi"
)
)
$root = array(
"id" => "Target___012367",
"name" => "T 012367",
"data" => array()
)
$clones = array()
$sclone = array(
"id" => "30416",
"target_id" => "012367",
"clone_suffix" => "7361",
"sequence_start" => "2",
"sequence_end" => "108",
"sequence" => "SLEDPFFVVKGEVQKALSRARSLYERWEELLEEGTQVSKDELDWSTNELRNCLRAIDWDLEDLSETISIVESNPGKFRLGENELQERRDFVERTRQAVQEMKEQLSS",
"sequence_comments" => null,
"local_protein_target_id" => "12924",
"local_clone_plate_id" => null,
"local_clone_id" => "7361",
"experiment_date_start" => "2011-07-20",
"experiment_date_end" => "2011-07-20",
"staff_id" => "23",
"other_people" => null,
"lab_id" => "AECOM",
"protocol_id" => "Ligation Independent Cloning",
"status" => "success",
"vector" => "pSGC",
"pcr_primer_forward" => "TACTTCCAATCCATGTCGCTGGAGGACCCATTCTTC",
"pcr_primer_backward" => "tatccacctttactgttaAGAGGACAGCTGTTCCTTCATC",
"shipped_to_lab_id" => null,
"shipped_date" => null,
"inserted" => "2011-07-25 22:01:38.549156+00",
"ins_user_id" => null,
"update" => "2014-05-20 02:01:17.455548+00",
"upd_user_id" => "1",
"secondary_shipped_to_lab_id" => null,
"secondary_shipped_date" => null,
"external_source" => false,
"mutation" => null,
"bei_available" => false,
"bei_number" => null,
"reference_sequence_variance" => null,
"confirmed_dna_sequence" => null,
"confirmed_protein_sequence" => null,
"present_in_lims" => false,
"template_dna_sequence" => "TCGCTGGAGGACCCATTCTTCGTTGTTAAGGGAGAGGTTCAAAAGGCCCTGAGCAGAGCCCGTTCACTGTACGAGCGTTGGGAAGAGCTGCTCGAGGAAGGTACCCAGGTCTCGAAGGACGAGCTGGATTGGTCAACTAACGAATTGAGGAACTGCCTGAGAGCTATCGACTGGGATCTGGAGGACCTCTCTGAAACTATCAGCATCGTTGAGTCAAACCCCGGCAAGTTCAGGCTGGGCGAGAACGAACTCCAAGAGCGTCGCGACTTCGTGGAACGTACACGCCAAGCCGTCCAGGAGATGAAGGAACAGCTGTCCTCT",
"lims_date" => "2011-07-25",
"dummy" => false,
"type" => null,
"clone_annotation" => null,
"optimized_dna_sequence" => null,
"optimized" => false,
"truncated" => false,
"synthetic" => false,
"Staff" => array(
"id" => "23",
"first_name" => "Brandan",
"last_name" => "Hillerich",
"email" => "brandan.hillerich@einstein.yu.edu",
"phone" => null,
"lab_id" => "AECOM",
"responsibility" => null,
"databases" => false,
"admin" => false,
"protein_production" => false,
"crystallography" => false,
"pi" => false,
"lab_contact" => false,
"inserted" => "2010-11-16 22:19:15.566353+00",
"updated" => "2010-11-16 22:19:15.566353+00",
"institution_id" => "1",
"middle_initials" => null,
"active" => true,
"manager" => false,
"function" => null,
"real_id" => "23"
),
"Expression" => array(
array(),
array()
)
)
$iclone = array(
"id" => "ProteinClone___30416",
"name" => "C .07/20/11",
"data" => array(),
"children" => array()
)
$sexpr = array(
"id" => "3903",
"target_id" => "012367",
"expression_suffix" => "5087",
"clone_id" => "30416",
"clone_suffix" => "7361",
"local_clone_id" => "7361",
"local_protein_target_id" => "12924",
"local_expression_id" => "5087",
"experiment_date_start" => "2011-07-20",
"experiment_date_end" => "2011-07-20",
"staff_id" => "23",
"other_people" => null,
"lab_id" => "AECOM",
"protocol_id" => "SS Expression and Purification",
"status" => "success",
"expression_organism" => "E. coli",
"expression_strain" => "BL21 (DE3) RIL",
"media_type" => "PASM-5052",
"media_volume" => "0.75",
"growth_temperature" => "37",
"induction_temperature" => "37",
"induction_reagent" => "IPTG",
"experiment_type" => "assay",
"expression_level" => "100",
"solubility_level" => "100",
"inserted" => "2011-09-07 20:02:59.836986+00",
"ins_user_id" => null,
"update" => "2014-05-19 02:14:13.723369+00",
"upd_user_id" => "1",
"present_in_lims" => false,
"lims_date" => "2011-09-07",
"dummy" => false,
"Staff" => array(
"id" => "23",
"first_name" => "Brandan",
"last_name" => "Hillerich",
"email" => "brandan.hillerich@einstein.yu.edu",
"phone" => null,
"lab_id" => "AECOM",
"responsibility" => null,
"databases" => false,
"admin" => false,
"protein_production" => false,
"crystallography" => false,
"pi" => false,
"lab_contact" => false,
"inserted" => "2010-11-16 22:19:15.566353+00",
"updated" => "2010-11-16 22:19:15.566353+00",
"institution_id" => "1",
"middle_initials" => null,
"active" => true,
"manager" => false,
"function" => null,
"real_id" => "23"
),
"Purification" => array(
array(),
array()
)
)
$iexpr = array(
"id" => "Expression___3903",
"name" => "E .07/20/11",
"data" => array(),
"children" => array()
)
$expression_level = "100.0%"
$solubility_level = "100.0%"
$spur = array(
"id" => "592",
"target_id" => "012367",
"purification_suffix" => "1085",
"expression_id" => "3903",
"local_expression_id" => "5087",
"local_protein_target_id" => "12924",
"local_purification_id" => "1085",
"experiment_date_start" => "2011-08-05",
"experiment_date_end" => "2011-08-06",
"staff_id" => "217",
"other_people" => null,
"lab_id" => "AECOM",
"protocol_id" => "Large-Scale Automated Protein Purification",
"status" => "success",
"description" => "",
"affinity_tag_status" => "na",
"semet_status" => "native",
"covalent_modification" => null,
"final_buffer" => "",
"final_concentration" => "0.29",
"final_volume" => "9000",
"shipped_to_lab_id" => null,
"shipped_date" => null,
"inserted" => "2011-09-07 20:41:22.435005+00",
"ins_user_id" => null,
"update" => "2014-05-19 02:28:40.083311+00",
"upd_user_id" => "1",
"present_in_lims" => false,
"lims_date" => "2011-09-07",
"dummy" => false,
"yield" => null,
"Staff" => array(
"id" => "217",
"first_name" => "Anthony",
"last_name" => "Gizzi",
"email" => "anthony.gizzi@einstein.yu.edu",
"phone" => null,
"lab_id" => "AECOM",
"responsibility" => null,
"databases" => false,
"admin" => false,
"protein_production" => false,
"crystallography" => false,
"pi" => false,
"lab_contact" => false,
"inserted" => "2010-12-16 19:07:17.464208+00",
"updated" => "2010-12-16 19:07:17.464208+00",
"institution_id" => "1",
"middle_initials" => null,
"active" => true,
"manager" => false,
"function" => null,
"real_id" => "217"
),
"CrystallizationDrop" => array(),
"Hsqc" => array()
)
$ipur = array(
"id" => "Purification___592",
"name" => "P .08/05/11"
)
Unitrack_SpaceTreeController::create_JSON() - /var/www/unitrack/controllers/unitrack_space_tree_controller.php, line 205
Unitrack_SpaceTreeController::view() - /var/www/unitrack/controllers/unitrack_space_tree_controller.php, line 48
Dispatcher::_invoke() - CORE/cake/dispatcher.php, line 204
Dispatcher::dispatch() - CORE/cake/dispatcher.php, line 171
[main] - APP/webroot/index.php, line 83