011693 |
1 - 481 |
|
Notice (8): Undefined index: score [/var/www/unitrack/views/subtargets/unitrack_index.ctp, line 52]Code | Context<?php include(UNITRACK . '/views/subtargets/unitrack_index.ctp'); ?>
$___viewFn = "/var/www/html/nysgrc/app/views/subtargets/index.ctp"
$___dataForView = array(
"colors" => array(
"work_stopped" => "#FFFFFF",
"selected" => "#F0F0F0",
"cloned" => "#E0E0E0",
"expressed" => "#D0D0D0",
"soluble" => "#C0C0C0",
"purified" => "#B0B0B0",
"crystallized" => "#E0C0C0",
"diffraction" => "#F0C0C0",
"in_pdb" => "#FFC0C0"
),
"subtargets" => array(
array()
),
"view_own" => true,
"view_others" => true,
"edit_admin" => false,
"edit_other_profile" => false,
"edit_group_profile" => false,
"edit_own_profile" => false,
"edit_others" => false,
"edit_group" => false,
"edit_own" => false,
"view_request" => false,
"view_group" => true,
"view_contact_only" => false,
"view_pi_only" => false,
"view_vip_only" => false,
"controller" => SubtargetsController
SubtargetsController::$name = "Subtargets"
SubtargetsController::$helpers = array
SubtargetsController::$restrict = array
SubtargetsController::$uses = array
SubtargetsController::$components = array
SubtargetsController::$publicControllers = array
SubtargetsController::$here = "/nysgrc/subtargets/index/011693"
SubtargetsController::$webroot = "/nysgrc/"
SubtargetsController::$action = "index"
SubtargetsController::$params = array
SubtargetsController::$data = NULL
SubtargetsController::$paginate = array
SubtargetsController::$viewPath = "subtargets"
SubtargetsController::$layoutPath = NULL
SubtargetsController::$viewVars = array
SubtargetsController::$modelNames = array
SubtargetsController::$base = "/nysgrc"
SubtargetsController::$layout = "default"
SubtargetsController::$autoRender = false
SubtargetsController::$autoLayout = true
SubtargetsController::$Component = Component object
SubtargetsController::$view = "View"
SubtargetsController::$ext = ".ctp"
SubtargetsController::$output = NULL
SubtargetsController::$plugin = NULL
SubtargetsController::$cacheAction = false
SubtargetsController::$persistModel = false
SubtargetsController::$passedArgs = array
SubtargetsController::$scaffold = false
SubtargetsController::$methods = array
SubtargetsController::$modelClass = "Subtarget"
SubtargetsController::$modelKey = "subtarget"
SubtargetsController::$validationErrors = NULL
SubtargetsController::$__httpCodes = NULL
SubtargetsController::$Auth = AuthComponent object
SubtargetsController::$RequestHandler = RequestHandlerComponent object
SubtargetsController::$Session = SessionComponent object
SubtargetsController::$Toolbox = ToolboxComponent object
SubtargetsController::$DataPipeline = DataPipelineComponent object
SubtargetsController::$Subtarget = Subtarget object
SubtargetsController::$SubtargetAssignment = SubtargetAssignment object
SubtargetsController::$Lab = Lab object
SubtargetsController::$User = User object
)
$loadHelpers = true
$cached = false
$paginator = PaginatorHelper
PaginatorHelper::$helpers = array
PaginatorHelper::$__defaultModel = "Subtarget"
PaginatorHelper::$_ajaxHelperClass = "Js"
PaginatorHelper::$options = array
PaginatorHelper::$base = "/nysgrc"
PaginatorHelper::$webroot = "/nysgrc/"
PaginatorHelper::$theme = NULL
PaginatorHelper::$here = "/nysgrc/subtargets/index/011693"
PaginatorHelper::$params = array
PaginatorHelper::$action = "index"
PaginatorHelper::$plugin = NULL
PaginatorHelper::$data = NULL
PaginatorHelper::$namedArgs = NULL
PaginatorHelper::$argSeparator = NULL
PaginatorHelper::$validationErrors = NULL
PaginatorHelper::$tags = array
PaginatorHelper::$__tainted = NULL
PaginatorHelper::$__cleaned = NULL
PaginatorHelper::$Html = HtmlHelper object
PaginatorHelper::$Js = JsHelper object
$date = DateHelper
DateHelper::$helpers = NULL
DateHelper::$base = "/nysgrc"
DateHelper::$webroot = "/nysgrc/"
DateHelper::$theme = NULL
DateHelper::$here = "/nysgrc/subtargets/index/011693"
DateHelper::$params = array
DateHelper::$action = "index"
DateHelper::$plugin = NULL
DateHelper::$data = NULL
DateHelper::$namedArgs = NULL
DateHelper::$argSeparator = NULL
DateHelper::$validationErrors = NULL
DateHelper::$tags = array
DateHelper::$__tainted = NULL
DateHelper::$__cleaned = NULL
$jqueryEngine = JqueryEngineHelper
JqueryEngineHelper::$_optionMap = array
JqueryEngineHelper::$_callbackArguments = array
JqueryEngineHelper::$jQueryObject = "$"
JqueryEngineHelper::$useNative = true
JqueryEngineHelper::$selection = NULL
JqueryEngineHelper::$bufferedMethods = array
JqueryEngineHelper::$helpers = NULL
JqueryEngineHelper::$base = "/nysgrc"
JqueryEngineHelper::$webroot = "/nysgrc/"
JqueryEngineHelper::$theme = NULL
JqueryEngineHelper::$here = "/nysgrc/subtargets/index/011693"
JqueryEngineHelper::$params = array
JqueryEngineHelper::$action = "index"
JqueryEngineHelper::$plugin = NULL
JqueryEngineHelper::$data = NULL
JqueryEngineHelper::$namedArgs = NULL
JqueryEngineHelper::$argSeparator = NULL
JqueryEngineHelper::$validationErrors = NULL
JqueryEngineHelper::$tags = array
JqueryEngineHelper::$__tainted = NULL
JqueryEngineHelper::$__cleaned = NULL
$js = JsHelper
JsHelper::$bufferScripts = true
JsHelper::$helpers = array
JsHelper::$__jsVars = array
JsHelper::$__bufferedScripts = array
JsHelper::$__engineName = "JqueryEngine"
JsHelper::$setVariable = "app"
JsHelper::$base = "/nysgrc"
JsHelper::$webroot = "/nysgrc/"
JsHelper::$theme = NULL
JsHelper::$here = "/nysgrc/subtargets/index/011693"
JsHelper::$params = array
JsHelper::$action = "index"
JsHelper::$plugin = NULL
JsHelper::$data = NULL
JsHelper::$namedArgs = NULL
JsHelper::$argSeparator = NULL
JsHelper::$validationErrors = NULL
JsHelper::$tags = array
JsHelper::$__tainted = NULL
JsHelper::$__cleaned = NULL
JsHelper::$Html = HtmlHelper object
JsHelper::$Form = FormHelper object
JsHelper::$JqueryEngine = JqueryEngineHelper object
$form = FormHelper
FormHelper::$helpers = array
FormHelper::$fieldset = array
FormHelper::$__options = array
FormHelper::$fields = array
FormHelper::$requestType = NULL
FormHelper::$defaultModel = NULL
FormHelper::$_inputDefaults = array
FormHelper::$_lastAction = ""
FormHelper::$base = "/nysgrc"
FormHelper::$webroot = "/nysgrc/"
FormHelper::$theme = NULL
FormHelper::$here = "/nysgrc/subtargets/index/011693"
FormHelper::$params = array
FormHelper::$action = "index"
FormHelper::$plugin = NULL
FormHelper::$data = NULL
FormHelper::$namedArgs = NULL
FormHelper::$argSeparator = NULL
FormHelper::$validationErrors = NULL
FormHelper::$tags = array
FormHelper::$__tainted = NULL
FormHelper::$__cleaned = NULL
FormHelper::$Html = HtmlHelper object
$javascript = JavascriptHelper
JavascriptHelper::$useNative = true
JavascriptHelper::$enabled = true
JavascriptHelper::$safe = false
JavascriptHelper::$tags = array
JavascriptHelper::$_blockOptions = array
JavascriptHelper::$_cachedEvents = array
JavascriptHelper::$_cacheEvents = false
JavascriptHelper::$_cacheToFile = false
JavascriptHelper::$_cacheAll = false
JavascriptHelper::$_rules = array
JavascriptHelper::$__scriptBuffer = NULL
JavascriptHelper::$helpers = NULL
JavascriptHelper::$base = "/nysgrc"
JavascriptHelper::$webroot = "/nysgrc/"
JavascriptHelper::$theme = NULL
JavascriptHelper::$here = "/nysgrc/subtargets/index/011693"
JavascriptHelper::$params = array
JavascriptHelper::$action = "index"
JavascriptHelper::$plugin = NULL
JavascriptHelper::$data = NULL
JavascriptHelper::$namedArgs = NULL
JavascriptHelper::$argSeparator = NULL
JavascriptHelper::$validationErrors = NULL
JavascriptHelper::$__tainted = NULL
JavascriptHelper::$__cleaned = NULL
$ajax = AjaxHelper
AjaxHelper::$helpers = array
AjaxHelper::$Html = HtmlHelper object
AjaxHelper::$Javascript = JavascriptHelper object
AjaxHelper::$callbacks = array
AjaxHelper::$ajaxOptions = array
AjaxHelper::$dragOptions = array
AjaxHelper::$dropOptions = array
AjaxHelper::$sortOptions = array
AjaxHelper::$sliderOptions = array
AjaxHelper::$editorOptions = array
AjaxHelper::$autoCompleteOptions = array
AjaxHelper::$__ajaxBuffer = array
AjaxHelper::$base = "/nysgrc"
AjaxHelper::$webroot = "/nysgrc/"
AjaxHelper::$theme = NULL
AjaxHelper::$here = "/nysgrc/subtargets/index/011693"
AjaxHelper::$params = array
AjaxHelper::$action = "index"
AjaxHelper::$plugin = NULL
AjaxHelper::$data = NULL
AjaxHelper::$namedArgs = NULL
AjaxHelper::$argSeparator = NULL
AjaxHelper::$validationErrors = NULL
AjaxHelper::$tags = array
AjaxHelper::$__tainted = NULL
AjaxHelper::$__cleaned = NULL
AjaxHelper::$Form = FormHelper object
$session = SessionHelper
SessionHelper::$helpers = array
SessionHelper::$__active = true
SessionHelper::$valid = false
SessionHelper::$error = false
SessionHelper::$_userAgent = "5a088fb542c1b540ccb30719553be0ff"
SessionHelper::$path = "/"
SessionHelper::$lastError = NULL
SessionHelper::$security = "medium"
SessionHelper::$time = 1618309788
SessionHelper::$sessionTime = 1618321788
SessionHelper::$cookieLifeTime = false
SessionHelper::$watchKeys = array
SessionHelper::$id = NULL
SessionHelper::$host = NULL
SessionHelper::$timeout = NULL
SessionHelper::$base = "/nysgrc"
SessionHelper::$webroot = "/nysgrc/"
SessionHelper::$here = "/nysgrc/subtargets/index/011693"
SessionHelper::$params = array
SessionHelper::$action = "index"
SessionHelper::$data = NULL
SessionHelper::$theme = NULL
SessionHelper::$plugin = NULL
$html = HtmlHelper
HtmlHelper::$tags = array
HtmlHelper::$_crumbs = array
HtmlHelper::$__includedScripts = array
HtmlHelper::$_scriptBlockOptions = array
HtmlHelper::$__docTypes = array
HtmlHelper::$helpers = NULL
HtmlHelper::$base = "/nysgrc"
HtmlHelper::$webroot = "/nysgrc/"
HtmlHelper::$theme = NULL
HtmlHelper::$here = "/nysgrc/subtargets/index/011693"
HtmlHelper::$params = array
HtmlHelper::$action = "index"
HtmlHelper::$plugin = NULL
HtmlHelper::$data = NULL
HtmlHelper::$namedArgs = NULL
HtmlHelper::$argSeparator = NULL
HtmlHelper::$validationErrors = NULL
HtmlHelper::$__tainted = NULL
HtmlHelper::$__cleaned = NULL
$actions = ActionsHelper
ActionsHelper::$helpers = array
ActionsHelper::$addIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_01.png"
ActionsHelper::$listIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_61.png"
ActionsHelper::$deleteIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_02.png"
ActionsHelper::$editIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_45.png"
ActionsHelper::$loginIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_59.png"
ActionsHelper::$logoutIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_51.png"
ActionsHelper::$cancelIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_05.png"
ActionsHelper::$okIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_06.png"
ActionsHelper::$settingsIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_41.png"
ActionsHelper::$bugIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_50.png"
ActionsHelper::$menuIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_20.png"
ActionsHelper::$lockIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_42.png"
ActionsHelper::$warningIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_11.png"
ActionsHelper::$internalIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_37.png"
ActionsHelper::$base = "/nysgrc"
ActionsHelper::$webroot = "/nysgrc/"
ActionsHelper::$theme = NULL
ActionsHelper::$here = "/nysgrc/subtargets/index/011693"
ActionsHelper::$params = array
ActionsHelper::$action = "index"
ActionsHelper::$plugin = NULL
ActionsHelper::$data = NULL
ActionsHelper::$namedArgs = NULL
ActionsHelper::$argSeparator = NULL
ActionsHelper::$validationErrors = NULL
ActionsHelper::$tags = array
ActionsHelper::$__tainted = NULL
ActionsHelper::$__cleaned = NULL
ActionsHelper::$Html = HtmlHelper object
ActionsHelper::$Session = SessionHelper object
ActionsHelper::$Ajax = AjaxHelper object
$colors = array(
"work_stopped" => "#FFFFFF",
"selected" => "#F0F0F0",
"cloned" => "#E0E0E0",
"expressed" => "#D0D0D0",
"soluble" => "#C0C0C0",
"purified" => "#B0B0B0",
"crystallized" => "#E0C0C0",
"diffraction" => "#F0C0C0",
"in_pdb" => "#FFC0C0"
)
$subtargets = array(
array(
"Subtarget" => array(),
"Target" => array(),
"Assignment" => array()
)
)
$view_own = true
$view_others = true
$edit_admin = false
$edit_other_profile = false
$edit_group_profile = false
$edit_own_profile = false
$edit_others = false
$edit_group = false
$edit_own = false
$view_request = false
$view_group = true
$view_contact_only = false
$view_pi_only = false
$view_vip_only = false
$controller = SubtargetsController
SubtargetsController::$name = "Subtargets"
SubtargetsController::$helpers = array
SubtargetsController::$restrict = array
SubtargetsController::$uses = array
SubtargetsController::$components = array
SubtargetsController::$publicControllers = array
SubtargetsController::$here = "/nysgrc/subtargets/index/011693"
SubtargetsController::$webroot = "/nysgrc/"
SubtargetsController::$action = "index"
SubtargetsController::$params = array
SubtargetsController::$data = NULL
SubtargetsController::$paginate = array
SubtargetsController::$viewPath = "subtargets"
SubtargetsController::$layoutPath = NULL
SubtargetsController::$viewVars = array
SubtargetsController::$modelNames = array
SubtargetsController::$base = "/nysgrc"
SubtargetsController::$layout = "default"
SubtargetsController::$autoRender = false
SubtargetsController::$autoLayout = true
SubtargetsController::$Component = Component object
SubtargetsController::$view = "View"
SubtargetsController::$ext = ".ctp"
SubtargetsController::$output = NULL
SubtargetsController::$plugin = NULL
SubtargetsController::$cacheAction = false
SubtargetsController::$persistModel = false
SubtargetsController::$passedArgs = array
SubtargetsController::$scaffold = false
SubtargetsController::$methods = array
SubtargetsController::$modelClass = "Subtarget"
SubtargetsController::$modelKey = "subtarget"
SubtargetsController::$validationErrors = NULL
SubtargetsController::$__httpCodes = NULL
SubtargetsController::$Auth = AuthComponent object
SubtargetsController::$RequestHandler = RequestHandlerComponent object
SubtargetsController::$Session = SessionComponent object
SubtargetsController::$Toolbox = ToolboxComponent object
SubtargetsController::$DataPipeline = DataPipelineComponent object
SubtargetsController::$Subtarget = Subtarget object
SubtargetsController::$SubtargetAssignment = SubtargetAssignment object
SubtargetsController::$Lab = Lab object
SubtargetsController::$User = User object
$center_id = "NYSGRC"
$i = 1
$subtarget = array(
"Subtarget" => array(
"id" => "2502",
"target_id" => "011693",
"sequence_start" => "1",
"sequence_end" => "481",
"mutation" => "",
"sequence" => "MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHGDVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLSRMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGGVNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVSITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDLPIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLIREGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHLNVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRKLLTALKHAVDPEMIMNPGCQLRF",
"dna_sequence" => null,
"sequence_comments" => null,
"date_selected" => null,
"priority" => null,
"inserted" => "2011-08-12 21:03:11.208641+00",
"updated" => "2011-08-12 21:03:11.208641+00",
"lab_assigned" => "AECOM",
"date_assigned" => null
),
"Target" => array(
"id" => "11755",
"target_id" => "011693",
"local_target_id" => "011693",
"locus_tag" => "SMa0244",
"ncbi_gi" => "14523196",
"ncbi_accession" => "AAK64787.1",
"ncbi_geneid" => null,
"ncbi_taxon_id" => "266834",
"gene_name" => null,
"common_name" => "Dehydrogenase, FAD-dependent [Sinorhizobium meliloti 1021]",
"ncbi_coded_by_region" => "AE006469.1:134949..136394",
"ncbi_note" => "Contains pfam01565, FAD_binding_4, FAD binding domain; This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase; One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110; The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment; VAO catalyses the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols; Other members of this family include D-lactate dehydrogenase, this enzyme catalyses the conversion of D-lactate to pyruvate using FAD as a co- factor; mitomycin radical oxidase, this enzyme oxidises the reduced form of mitomycins and is involved in mitomycin resistance; This family includes MurB an UDP-N- acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158; This enzyme is involved in the biosynthesis of peptidoglycan, family membership",
"tigr_main_role_id" => null,
"tigr_sub_role_id" => null,
"comment" => null,
"justification" => "Model system for symbiosis and nitrogen fixation",
"sequence" => "MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHGDVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLSRMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGGVNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVSITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDLPIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLIREGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHLNVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRKLLTALKHAVDPEMIMNPGCQLRF",
"sequence_length" => "481",
"dna_sequence" => "ATGACAAGTGCAGGCACGATAGAGGATGCGAAAGGCCCTGCGGAACTGCGCCTGGCGCTGCGTCAGATGCTTGGTGAAGATATTGTGCTGAGCGAAACGGAGGAAATGCTCCGTTTCTGCCGCGACTGGCATGGCGACGTAACCACCGGCACCGTGGCGGTGATTCGCCCGCGCTCGACGCAGCAGGTGGCGGCGGCCGTGAAGGCCTGCCGGGAACTTGGGCTTTCGATCGTGCCGCAGGGCGGCAATACCGGCCTCGTGCTCGGCGCGATCCCCGATGCTCCGGAGAGGCAGGTCGTGCTTTCTCTCTCCCGCATGAACCGCATCCGCAAGATCGATCCGGCCGATTTTTCGGCGGTTGTCGAGTCCGGCTGCATCCTGTCCGAGCTCAAGGACGCGATTGCGAAGATGGGGATGTTCTTTCCGCTTGCGCTCGGCGCGCAGGGAAGCTGCCAGATCGGGGGAAATGTTTCGACGAATGCCGGCGGCGTCAATGTGCTCCGCTACGGCATGACCCGCGAACTGGTGCTGGGACTTGAAGTGGTCCTCCCGGACGGCAGCATCCTCGAAGGCCTGTCGACGTTGAGAAAGGACAATCGCGGCATCGACCTGAAGCAGCTGTTCATCGGTGCAGAAGGCACGCTCGGCATCATCACCGCCGTTTCCATCACGCTGACGCCCTATCCGGATCACGTAGCCACGGCGCTCCTCGGGCTCGCCTCCCTGGAAGATGCCATCAGGCTCTATCGCCGGGCGCGTCGGGACTGCTGCGACCTGATGTCGGCTTTCGAATTCATGCCGCCGCTCGCCTTTACCCTGGCGCAGGAGGCGATGCCCGATCTGCCGATCCCGATCTCGGCGGAATATCCGGCCTATGTGCTGATGGAGATTTCCGGCTCCGGCCTCGTCGATGTCGACGATCTGATGCAGCGCTTCCTCGAGGGTGCGATGGAGGAAGGGCTGGTCCTTGACGGAACGATCGCCGCCTCGCAGACGCAGGCGCGCAATCTTTGGTTGATCCGCGAGGGCATGAACGAAGGTCAGGCGAAACGCGGCACTCATATGCGCACCGATATCTCCGTACCGCTCTCACAGCTGGCCTCCTTCGTAGAGGAGGCGGAAAAGGCAGTGTCCGAGGCGCTTCCGGGCGCCGTCAGCGTTTCTTATGGTCATGTCGGCGACGGCAATGTGCATCTCAACGTCCTGCCGCCGGCCGGCAGTACGCCCGAGGAGCGGATCCAATTGATCTACAAGGCCAAGACGGTCGTGAACGAGGTGCTCGACCGCTATACCGGAAGCATCAGCGCCGAGCACGGTATCGGGCGCCTGAAGCGCCCGGATTTCGACGCCAGGCTGCCCGCGACCCGCCGAAAGCTGTTGACGGCGCTCAAGCATGCCGTTGACCCGGAGATGATCATGAATCCCGGTTGTCAACTGAGATTCTAA",
"dna_sequence_ncbi" => null,
"priority" => "1",
"project" => "BIO:SINO (Sinorhizobium targets)",
"selection_phase" => null,
"date_selected" => "2011-06-29",
"date_approved" => "2011-06-29",
"completion_code" => null,
"pi" => null,
"tms" => null,
"sp" => null,
"core_genome" => null,
"gram_minus_gene_homolog" => null,
"gram_plus_gene_homolog" => null,
"protease_motifs" => null,
"glycosyl_group_metabolism" => null,
"study_id" => null,
"drug_target_homologs" => null,
"virulence_genes" => null,
"essential_genes_homologs" => null,
"dna_binding_motifs" => null,
"inserted" => "2011-06-29 19:35:00.35038+00",
"updated" => "2011-06-29 19:35:00.35038+00",
"species_taxon_id" => "382",
"ins_user_id" => "2",
"upd_user_id" => null,
"stage" => "purified",
"hidden" => false,
"submitter_id" => null,
"selection_db_id" => null,
"dna_source_taxon_id" => null,
"batch" => "sinorizobium_batch1",
"genus_taxon_id" => "28105",
"seguid" => null,
"uniprot_id" => null,
"ec" => null,
"target_family" => null,
"tar_designpool_id" => null,
"community_nominated" => false,
"partnership_nominated" => null,
"biomedical" => true,
"metagenomic" => false,
"structural_coverage" => false,
"psi2" => false,
"legacy" => false,
"complex_with_biological_partner" => false,
"functional_mutant" => false,
"conformational_state" => false,
"disease" => false,
"individual_organism" => false,
"protein_family_of_high_biological_importance" => false,
"general_domain_family" => false,
"eukaryotic_domain_family" => false,
"first_structure_of_class" => false,
"functional_follow_up" => false,
"technology_development" => false,
"membrane_protein" => false,
"translated_dna_sequence" => null,
"family_coverage" => null,
"family_coverage_date" => null,
"distribution_lab" => null,
"uniprot_accession" => null,
"protocol_id" => "Target_selection",
"ensembl_protein_id" => null,
"ensembl_gene_id" => null,
"type" => "single protein",
"ligand_studies" => false,
"protein_production_for_partnerships" => false,
"single_domain_protein" => false,
"multidomain_protein" => false,
"oligomeric_protein" => false,
"eukaryotic_protein" => false,
"protein_protein_complex" => false,
"protein_nucleic_acid_complex" => false,
"protein_ligand_complex" => false,
"de_novo_designed_protein" => false,
"post_translational_modification" => false
),
"Assignment" => array(
array()
)
)
$lclass = " class="link altrow""
$class = " class="altrow""
$rand = 1173102088 include - /var/www/unitrack/views/subtargets/unitrack_index.ctp, line 52
include - APP/views/subtargets/index.ctp, line 1
View::_render() - CORE/cake/libs/view/view.php, line 736
View::render() - CORE/cake/libs/view/view.php, line 431
Controller::render() - CORE/cake/libs/controller/controller.php, line 909
Dispatcher::_invoke() - CORE/cake/dispatcher.php, line 207
Dispatcher::dispatch() - CORE/cake/dispatcher.php, line 171
[main] - APP/webroot/index.php, line 83 |
Notice (8): Undefined index: xtalpred [/var/www/unitrack/views/subtargets/unitrack_index.ctp, line 55]Code | Context<?php include(UNITRACK . '/views/subtargets/unitrack_index.ctp'); ?>
$___viewFn = "/var/www/html/nysgrc/app/views/subtargets/index.ctp"
$___dataForView = array(
"colors" => array(
"work_stopped" => "#FFFFFF",
"selected" => "#F0F0F0",
"cloned" => "#E0E0E0",
"expressed" => "#D0D0D0",
"soluble" => "#C0C0C0",
"purified" => "#B0B0B0",
"crystallized" => "#E0C0C0",
"diffraction" => "#F0C0C0",
"in_pdb" => "#FFC0C0"
),
"subtargets" => array(
array()
),
"view_own" => true,
"view_others" => true,
"edit_admin" => false,
"edit_other_profile" => false,
"edit_group_profile" => false,
"edit_own_profile" => false,
"edit_others" => false,
"edit_group" => false,
"edit_own" => false,
"view_request" => false,
"view_group" => true,
"view_contact_only" => false,
"view_pi_only" => false,
"view_vip_only" => false,
"controller" => SubtargetsController
SubtargetsController::$name = "Subtargets"
SubtargetsController::$helpers = array
SubtargetsController::$restrict = array
SubtargetsController::$uses = array
SubtargetsController::$components = array
SubtargetsController::$publicControllers = array
SubtargetsController::$here = "/nysgrc/subtargets/index/011693"
SubtargetsController::$webroot = "/nysgrc/"
SubtargetsController::$action = "index"
SubtargetsController::$params = array
SubtargetsController::$data = NULL
SubtargetsController::$paginate = array
SubtargetsController::$viewPath = "subtargets"
SubtargetsController::$layoutPath = NULL
SubtargetsController::$viewVars = array
SubtargetsController::$modelNames = array
SubtargetsController::$base = "/nysgrc"
SubtargetsController::$layout = "default"
SubtargetsController::$autoRender = false
SubtargetsController::$autoLayout = true
SubtargetsController::$Component = Component object
SubtargetsController::$view = "View"
SubtargetsController::$ext = ".ctp"
SubtargetsController::$output = NULL
SubtargetsController::$plugin = NULL
SubtargetsController::$cacheAction = false
SubtargetsController::$persistModel = false
SubtargetsController::$passedArgs = array
SubtargetsController::$scaffold = false
SubtargetsController::$methods = array
SubtargetsController::$modelClass = "Subtarget"
SubtargetsController::$modelKey = "subtarget"
SubtargetsController::$validationErrors = NULL
SubtargetsController::$__httpCodes = NULL
SubtargetsController::$Auth = AuthComponent object
SubtargetsController::$RequestHandler = RequestHandlerComponent object
SubtargetsController::$Session = SessionComponent object
SubtargetsController::$Toolbox = ToolboxComponent object
SubtargetsController::$DataPipeline = DataPipelineComponent object
SubtargetsController::$Subtarget = Subtarget object
SubtargetsController::$SubtargetAssignment = SubtargetAssignment object
SubtargetsController::$Lab = Lab object
SubtargetsController::$User = User object
)
$loadHelpers = true
$cached = false
$paginator = PaginatorHelper
PaginatorHelper::$helpers = array
PaginatorHelper::$__defaultModel = "Subtarget"
PaginatorHelper::$_ajaxHelperClass = "Js"
PaginatorHelper::$options = array
PaginatorHelper::$base = "/nysgrc"
PaginatorHelper::$webroot = "/nysgrc/"
PaginatorHelper::$theme = NULL
PaginatorHelper::$here = "/nysgrc/subtargets/index/011693"
PaginatorHelper::$params = array
PaginatorHelper::$action = "index"
PaginatorHelper::$plugin = NULL
PaginatorHelper::$data = NULL
PaginatorHelper::$namedArgs = NULL
PaginatorHelper::$argSeparator = NULL
PaginatorHelper::$validationErrors = NULL
PaginatorHelper::$tags = array
PaginatorHelper::$__tainted = NULL
PaginatorHelper::$__cleaned = NULL
PaginatorHelper::$Html = HtmlHelper object
PaginatorHelper::$Js = JsHelper object
$date = DateHelper
DateHelper::$helpers = NULL
DateHelper::$base = "/nysgrc"
DateHelper::$webroot = "/nysgrc/"
DateHelper::$theme = NULL
DateHelper::$here = "/nysgrc/subtargets/index/011693"
DateHelper::$params = array
DateHelper::$action = "index"
DateHelper::$plugin = NULL
DateHelper::$data = NULL
DateHelper::$namedArgs = NULL
DateHelper::$argSeparator = NULL
DateHelper::$validationErrors = NULL
DateHelper::$tags = array
DateHelper::$__tainted = NULL
DateHelper::$__cleaned = NULL
$jqueryEngine = JqueryEngineHelper
JqueryEngineHelper::$_optionMap = array
JqueryEngineHelper::$_callbackArguments = array
JqueryEngineHelper::$jQueryObject = "$"
JqueryEngineHelper::$useNative = true
JqueryEngineHelper::$selection = NULL
JqueryEngineHelper::$bufferedMethods = array
JqueryEngineHelper::$helpers = NULL
JqueryEngineHelper::$base = "/nysgrc"
JqueryEngineHelper::$webroot = "/nysgrc/"
JqueryEngineHelper::$theme = NULL
JqueryEngineHelper::$here = "/nysgrc/subtargets/index/011693"
JqueryEngineHelper::$params = array
JqueryEngineHelper::$action = "index"
JqueryEngineHelper::$plugin = NULL
JqueryEngineHelper::$data = NULL
JqueryEngineHelper::$namedArgs = NULL
JqueryEngineHelper::$argSeparator = NULL
JqueryEngineHelper::$validationErrors = NULL
JqueryEngineHelper::$tags = array
JqueryEngineHelper::$__tainted = NULL
JqueryEngineHelper::$__cleaned = NULL
$js = JsHelper
JsHelper::$bufferScripts = true
JsHelper::$helpers = array
JsHelper::$__jsVars = array
JsHelper::$__bufferedScripts = array
JsHelper::$__engineName = "JqueryEngine"
JsHelper::$setVariable = "app"
JsHelper::$base = "/nysgrc"
JsHelper::$webroot = "/nysgrc/"
JsHelper::$theme = NULL
JsHelper::$here = "/nysgrc/subtargets/index/011693"
JsHelper::$params = array
JsHelper::$action = "index"
JsHelper::$plugin = NULL
JsHelper::$data = NULL
JsHelper::$namedArgs = NULL
JsHelper::$argSeparator = NULL
JsHelper::$validationErrors = NULL
JsHelper::$tags = array
JsHelper::$__tainted = NULL
JsHelper::$__cleaned = NULL
JsHelper::$Html = HtmlHelper object
JsHelper::$Form = FormHelper object
JsHelper::$JqueryEngine = JqueryEngineHelper object
$form = FormHelper
FormHelper::$helpers = array
FormHelper::$fieldset = array
FormHelper::$__options = array
FormHelper::$fields = array
FormHelper::$requestType = NULL
FormHelper::$defaultModel = NULL
FormHelper::$_inputDefaults = array
FormHelper::$_lastAction = ""
FormHelper::$base = "/nysgrc"
FormHelper::$webroot = "/nysgrc/"
FormHelper::$theme = NULL
FormHelper::$here = "/nysgrc/subtargets/index/011693"
FormHelper::$params = array
FormHelper::$action = "index"
FormHelper::$plugin = NULL
FormHelper::$data = NULL
FormHelper::$namedArgs = NULL
FormHelper::$argSeparator = NULL
FormHelper::$validationErrors = NULL
FormHelper::$tags = array
FormHelper::$__tainted = NULL
FormHelper::$__cleaned = NULL
FormHelper::$Html = HtmlHelper object
$javascript = JavascriptHelper
JavascriptHelper::$useNative = true
JavascriptHelper::$enabled = true
JavascriptHelper::$safe = false
JavascriptHelper::$tags = array
JavascriptHelper::$_blockOptions = array
JavascriptHelper::$_cachedEvents = array
JavascriptHelper::$_cacheEvents = false
JavascriptHelper::$_cacheToFile = false
JavascriptHelper::$_cacheAll = false
JavascriptHelper::$_rules = array
JavascriptHelper::$__scriptBuffer = NULL
JavascriptHelper::$helpers = NULL
JavascriptHelper::$base = "/nysgrc"
JavascriptHelper::$webroot = "/nysgrc/"
JavascriptHelper::$theme = NULL
JavascriptHelper::$here = "/nysgrc/subtargets/index/011693"
JavascriptHelper::$params = array
JavascriptHelper::$action = "index"
JavascriptHelper::$plugin = NULL
JavascriptHelper::$data = NULL
JavascriptHelper::$namedArgs = NULL
JavascriptHelper::$argSeparator = NULL
JavascriptHelper::$validationErrors = NULL
JavascriptHelper::$__tainted = NULL
JavascriptHelper::$__cleaned = NULL
$ajax = AjaxHelper
AjaxHelper::$helpers = array
AjaxHelper::$Html = HtmlHelper object
AjaxHelper::$Javascript = JavascriptHelper object
AjaxHelper::$callbacks = array
AjaxHelper::$ajaxOptions = array
AjaxHelper::$dragOptions = array
AjaxHelper::$dropOptions = array
AjaxHelper::$sortOptions = array
AjaxHelper::$sliderOptions = array
AjaxHelper::$editorOptions = array
AjaxHelper::$autoCompleteOptions = array
AjaxHelper::$__ajaxBuffer = array
AjaxHelper::$base = "/nysgrc"
AjaxHelper::$webroot = "/nysgrc/"
AjaxHelper::$theme = NULL
AjaxHelper::$here = "/nysgrc/subtargets/index/011693"
AjaxHelper::$params = array
AjaxHelper::$action = "index"
AjaxHelper::$plugin = NULL
AjaxHelper::$data = NULL
AjaxHelper::$namedArgs = NULL
AjaxHelper::$argSeparator = NULL
AjaxHelper::$validationErrors = NULL
AjaxHelper::$tags = array
AjaxHelper::$__tainted = NULL
AjaxHelper::$__cleaned = NULL
AjaxHelper::$Form = FormHelper object
$session = SessionHelper
SessionHelper::$helpers = array
SessionHelper::$__active = true
SessionHelper::$valid = false
SessionHelper::$error = false
SessionHelper::$_userAgent = "5a088fb542c1b540ccb30719553be0ff"
SessionHelper::$path = "/"
SessionHelper::$lastError = NULL
SessionHelper::$security = "medium"
SessionHelper::$time = 1618309788
SessionHelper::$sessionTime = 1618321788
SessionHelper::$cookieLifeTime = false
SessionHelper::$watchKeys = array
SessionHelper::$id = NULL
SessionHelper::$host = NULL
SessionHelper::$timeout = NULL
SessionHelper::$base = "/nysgrc"
SessionHelper::$webroot = "/nysgrc/"
SessionHelper::$here = "/nysgrc/subtargets/index/011693"
SessionHelper::$params = array
SessionHelper::$action = "index"
SessionHelper::$data = NULL
SessionHelper::$theme = NULL
SessionHelper::$plugin = NULL
$html = HtmlHelper
HtmlHelper::$tags = array
HtmlHelper::$_crumbs = array
HtmlHelper::$__includedScripts = array
HtmlHelper::$_scriptBlockOptions = array
HtmlHelper::$__docTypes = array
HtmlHelper::$helpers = NULL
HtmlHelper::$base = "/nysgrc"
HtmlHelper::$webroot = "/nysgrc/"
HtmlHelper::$theme = NULL
HtmlHelper::$here = "/nysgrc/subtargets/index/011693"
HtmlHelper::$params = array
HtmlHelper::$action = "index"
HtmlHelper::$plugin = NULL
HtmlHelper::$data = NULL
HtmlHelper::$namedArgs = NULL
HtmlHelper::$argSeparator = NULL
HtmlHelper::$validationErrors = NULL
HtmlHelper::$__tainted = NULL
HtmlHelper::$__cleaned = NULL
$actions = ActionsHelper
ActionsHelper::$helpers = array
ActionsHelper::$addIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_01.png"
ActionsHelper::$listIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_61.png"
ActionsHelper::$deleteIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_02.png"
ActionsHelper::$editIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_45.png"
ActionsHelper::$loginIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_59.png"
ActionsHelper::$logoutIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_51.png"
ActionsHelper::$cancelIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_05.png"
ActionsHelper::$okIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_06.png"
ActionsHelper::$settingsIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_41.png"
ActionsHelper::$bugIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_50.png"
ActionsHelper::$menuIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_20.png"
ActionsHelper::$lockIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_42.png"
ActionsHelper::$warningIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_11.png"
ActionsHelper::$internalIconLoc = "/img/Fwdw_icons/standart/png/24x24/001_37.png"
ActionsHelper::$base = "/nysgrc"
ActionsHelper::$webroot = "/nysgrc/"
ActionsHelper::$theme = NULL
ActionsHelper::$here = "/nysgrc/subtargets/index/011693"
ActionsHelper::$params = array
ActionsHelper::$action = "index"
ActionsHelper::$plugin = NULL
ActionsHelper::$data = NULL
ActionsHelper::$namedArgs = NULL
ActionsHelper::$argSeparator = NULL
ActionsHelper::$validationErrors = NULL
ActionsHelper::$tags = array
ActionsHelper::$__tainted = NULL
ActionsHelper::$__cleaned = NULL
ActionsHelper::$Html = HtmlHelper object
ActionsHelper::$Session = SessionHelper object
ActionsHelper::$Ajax = AjaxHelper object
$colors = array(
"work_stopped" => "#FFFFFF",
"selected" => "#F0F0F0",
"cloned" => "#E0E0E0",
"expressed" => "#D0D0D0",
"soluble" => "#C0C0C0",
"purified" => "#B0B0B0",
"crystallized" => "#E0C0C0",
"diffraction" => "#F0C0C0",
"in_pdb" => "#FFC0C0"
)
$subtargets = array(
array(
"Subtarget" => array(),
"Target" => array(),
"Assignment" => array()
)
)
$view_own = true
$view_others = true
$edit_admin = false
$edit_other_profile = false
$edit_group_profile = false
$edit_own_profile = false
$edit_others = false
$edit_group = false
$edit_own = false
$view_request = false
$view_group = true
$view_contact_only = false
$view_pi_only = false
$view_vip_only = false
$controller = SubtargetsController
SubtargetsController::$name = "Subtargets"
SubtargetsController::$helpers = array
SubtargetsController::$restrict = array
SubtargetsController::$uses = array
SubtargetsController::$components = array
SubtargetsController::$publicControllers = array
SubtargetsController::$here = "/nysgrc/subtargets/index/011693"
SubtargetsController::$webroot = "/nysgrc/"
SubtargetsController::$action = "index"
SubtargetsController::$params = array
SubtargetsController::$data = NULL
SubtargetsController::$paginate = array
SubtargetsController::$viewPath = "subtargets"
SubtargetsController::$layoutPath = NULL
SubtargetsController::$viewVars = array
SubtargetsController::$modelNames = array
SubtargetsController::$base = "/nysgrc"
SubtargetsController::$layout = "default"
SubtargetsController::$autoRender = false
SubtargetsController::$autoLayout = true
SubtargetsController::$Component = Component object
SubtargetsController::$view = "View"
SubtargetsController::$ext = ".ctp"
SubtargetsController::$output = NULL
SubtargetsController::$plugin = NULL
SubtargetsController::$cacheAction = false
SubtargetsController::$persistModel = false
SubtargetsController::$passedArgs = array
SubtargetsController::$scaffold = false
SubtargetsController::$methods = array
SubtargetsController::$modelClass = "Subtarget"
SubtargetsController::$modelKey = "subtarget"
SubtargetsController::$validationErrors = NULL
SubtargetsController::$__httpCodes = NULL
SubtargetsController::$Auth = AuthComponent object
SubtargetsController::$RequestHandler = RequestHandlerComponent object
SubtargetsController::$Session = SessionComponent object
SubtargetsController::$Toolbox = ToolboxComponent object
SubtargetsController::$DataPipeline = DataPipelineComponent object
SubtargetsController::$Subtarget = Subtarget object
SubtargetsController::$SubtargetAssignment = SubtargetAssignment object
SubtargetsController::$Lab = Lab object
SubtargetsController::$User = User object
$center_id = "NYSGRC"
$i = 1
$subtarget = array(
"Subtarget" => array(
"id" => "2502",
"target_id" => "011693",
"sequence_start" => "1",
"sequence_end" => "481",
"mutation" => "",
"sequence" => "MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHGDVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLSRMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGGVNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVSITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDLPIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLIREGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHLNVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRKLLTALKHAVDPEMIMNPGCQLRF",
"dna_sequence" => null,
"sequence_comments" => null,
"date_selected" => null,
"priority" => null,
"inserted" => "2011-08-12 21:03:11.208641+00",
"updated" => "2011-08-12 21:03:11.208641+00",
"lab_assigned" => "AECOM",
"date_assigned" => null
),
"Target" => array(
"id" => "11755",
"target_id" => "011693",
"local_target_id" => "011693",
"locus_tag" => "SMa0244",
"ncbi_gi" => "14523196",
"ncbi_accession" => "AAK64787.1",
"ncbi_geneid" => null,
"ncbi_taxon_id" => "266834",
"gene_name" => null,
"common_name" => "Dehydrogenase, FAD-dependent [Sinorhizobium meliloti 1021]",
"ncbi_coded_by_region" => "AE006469.1:134949..136394",
"ncbi_note" => "Contains pfam01565, FAD_binding_4, FAD binding domain; This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase; One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110; The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment; VAO catalyses the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols; Other members of this family include D-lactate dehydrogenase, this enzyme catalyses the conversion of D-lactate to pyruvate using FAD as a co- factor; mitomycin radical oxidase, this enzyme oxidises the reduced form of mitomycins and is involved in mitomycin resistance; This family includes MurB an UDP-N- acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158; This enzyme is involved in the biosynthesis of peptidoglycan, family membership",
"tigr_main_role_id" => null,
"tigr_sub_role_id" => null,
"comment" => null,
"justification" => "Model system for symbiosis and nitrogen fixation",
"sequence" => "MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWHGDVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLSLSRMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTNAGGVNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGIITAVSITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQEAMPDLPIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQARNLWLIREGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHVGDGNVHLNVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDARLPATRRKLLTALKHAVDPEMIMNPGCQLRF",
"sequence_length" => "481",
"dna_sequence" => "ATGACAAGTGCAGGCACGATAGAGGATGCGAAAGGCCCTGCGGAACTGCGCCTGGCGCTGCGTCAGATGCTTGGTGAAGATATTGTGCTGAGCGAAACGGAGGAAATGCTCCGTTTCTGCCGCGACTGGCATGGCGACGTAACCACCGGCACCGTGGCGGTGATTCGCCCGCGCTCGACGCAGCAGGTGGCGGCGGCCGTGAAGGCCTGCCGGGAACTTGGGCTTTCGATCGTGCCGCAGGGCGGCAATACCGGCCTCGTGCTCGGCGCGATCCCCGATGCTCCGGAGAGGCAGGTCGTGCTTTCTCTCTCCCGCATGAACCGCATCCGCAAGATCGATCCGGCCGATTTTTCGGCGGTTGTCGAGTCCGGCTGCATCCTGTCCGAGCTCAAGGACGCGATTGCGAAGATGGGGATGTTCTTTCCGCTTGCGCTCGGCGCGCAGGGAAGCTGCCAGATCGGGGGAAATGTTTCGACGAATGCCGGCGGCGTCAATGTGCTCCGCTACGGCATGACCCGCGAACTGGTGCTGGGACTTGAAGTGGTCCTCCCGGACGGCAGCATCCTCGAAGGCCTGTCGACGTTGAGAAAGGACAATCGCGGCATCGACCTGAAGCAGCTGTTCATCGGTGCAGAAGGCACGCTCGGCATCATCACCGCCGTTTCCATCACGCTGACGCCCTATCCGGATCACGTAGCCACGGCGCTCCTCGGGCTCGCCTCCCTGGAAGATGCCATCAGGCTCTATCGCCGGGCGCGTCGGGACTGCTGCGACCTGATGTCGGCTTTCGAATTCATGCCGCCGCTCGCCTTTACCCTGGCGCAGGAGGCGATGCCCGATCTGCCGATCCCGATCTCGGCGGAATATCCGGCCTATGTGCTGATGGAGATTTCCGGCTCCGGCCTCGTCGATGTCGACGATCTGATGCAGCGCTTCCTCGAGGGTGCGATGGAGGAAGGGCTGGTCCTTGACGGAACGATCGCCGCCTCGCAGACGCAGGCGCGCAATCTTTGGTTGATCCGCGAGGGCATGAACGAAGGTCAGGCGAAACGCGGCACTCATATGCGCACCGATATCTCCGTACCGCTCTCACAGCTGGCCTCCTTCGTAGAGGAGGCGGAAAAGGCAGTGTCCGAGGCGCTTCCGGGCGCCGTCAGCGTTTCTTATGGTCATGTCGGCGACGGCAATGTGCATCTCAACGTCCTGCCGCCGGCCGGCAGTACGCCCGAGGAGCGGATCCAATTGATCTACAAGGCCAAGACGGTCGTGAACGAGGTGCTCGACCGCTATACCGGAAGCATCAGCGCCGAGCACGGTATCGGGCGCCTGAAGCGCCCGGATTTCGACGCCAGGCTGCCCGCGACCCGCCGAAAGCTGTTGACGGCGCTCAAGCATGCCGTTGACCCGGAGATGATCATGAATCCCGGTTGTCAACTGAGATTCTAA",
"dna_sequence_ncbi" => null,
"priority" => "1",
"project" => "BIO:SINO (Sinorhizobium targets)",
"selection_phase" => null,
"date_selected" => "2011-06-29",
"date_approved" => "2011-06-29",
"completion_code" => null,
"pi" => null,
"tms" => null,
"sp" => null,
"core_genome" => null,
"gram_minus_gene_homolog" => null,
"gram_plus_gene_homolog" => null,
"protease_motifs" => null,
"glycosyl_group_metabolism" => null,
"study_id" => null,
"drug_target_homologs" => null,
"virulence_genes" => null,
"essential_genes_homologs" => null,
"dna_binding_motifs" => null,
"inserted" => "2011-06-29 19:35:00.35038+00",
"updated" => "2011-06-29 19:35:00.35038+00",
"species_taxon_id" => "382",
"ins_user_id" => "2",
"upd_user_id" => null,
"stage" => "purified",
"hidden" => false,
"submitter_id" => null,
"selection_db_id" => null,
"dna_source_taxon_id" => null,
"batch" => "sinorizobium_batch1",
"genus_taxon_id" => "28105",
"seguid" => null,
"uniprot_id" => null,
"ec" => null,
"target_family" => null,
"tar_designpool_id" => null,
"community_nominated" => false,
"partnership_nominated" => null,
"biomedical" => true,
"metagenomic" => false,
"structural_coverage" => false,
"psi2" => false,
"legacy" => false,
"complex_with_biological_partner" => false,
"functional_mutant" => false,
"conformational_state" => false,
"disease" => false,
"individual_organism" => false,
"protein_family_of_high_biological_importance" => false,
"general_domain_family" => false,
"eukaryotic_domain_family" => false,
"first_structure_of_class" => false,
"functional_follow_up" => false,
"technology_development" => false,
"membrane_protein" => false,
"translated_dna_sequence" => null,
"family_coverage" => null,
"family_coverage_date" => null,
"distribution_lab" => null,
"uniprot_accession" => null,
"protocol_id" => "Target_selection",
"ensembl_protein_id" => null,
"ensembl_gene_id" => null,
"type" => "single protein",
"ligand_studies" => false,
"protein_production_for_partnerships" => false,
"single_domain_protein" => false,
"multidomain_protein" => false,
"oligomeric_protein" => false,
"eukaryotic_protein" => false,
"protein_protein_complex" => false,
"protein_nucleic_acid_complex" => false,
"protein_ligand_complex" => false,
"de_novo_designed_protein" => false,
"post_translational_modification" => false
),
"Assignment" => array(
array()
)
)
$lclass = " class="link altrow""
$class = " class="altrow""
$rand = 1173102088 include - /var/www/unitrack/views/subtargets/unitrack_index.ctp, line 55
include - APP/views/subtargets/index.ctp, line 1
View::_render() - CORE/cake/libs/view/view.php, line 736
View::render() - CORE/cake/libs/view/view.php, line 431
Controller::render() - CORE/cake/libs/controller/controller.php, line 909
Dispatcher::_invoke() - CORE/cake/dispatcher.php, line 207
Dispatcher::dispatch() - CORE/cake/dispatcher.php, line 171
[main] - APP/webroot/index.php, line 83 |
AECOM |
|